PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462963844
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family MYB_related
Protein Properties Length: 205aa    MW: 23184.7 Da    PI: 4.4048
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462963844genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.76.6e-1463101646
                      HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   6 teEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      + E++l++ + k lG++ W++Ia++m+ gRt++++k++w++
        462963844  63 PSEEDLIISLQKVLGNR-WSSIAARMP-GRTDNEIKNYWNS 101
                      67***************.*********.***********95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.50647107IPR017930Myb domain
SMARTSM007173.0E-857105IPR001005SANT/Myb domain
SuperFamilySSF466892.18E-1163110IPR009057Homeodomain-like
PfamPF002494.3E-1263101IPR001005SANT/Myb domain
CDDcd001676.82E-1163100No hitNo description
Gene3DG3DSA:1.10.10.609.3E-1863104IPR009057Homeodomain-like