PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462963844
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family MYB_related
Protein Properties Length: 205aa    MW: 23184.7 Da    PI: 4.4048
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462963844genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.76.6e-1463101646
                      HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   6 teEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      + E++l++ + k lG++ W++Ia++m+ gRt++++k++w++
        462963844  63 PSEEDLIISLQKVLGNR-WSSIAARMP-GRTDNEIKNYWNS 101
                      67***************.*********.***********95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.50647107IPR017930Myb domain
SMARTSM007173.0E-857105IPR001005SANT/Myb domain
SuperFamilySSF466892.18E-1163110IPR009057Homeodomain-like
PfamPF002494.3E-1263101IPR001005SANT/Myb domain
CDDcd001676.82E-1163100No hitNo description
Gene3DG3DSA:1.10.10.609.3E-1863104IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 205 aa     Download sequence    Send to blast
MAPSVSLTVQ PKMLKPPNTV IYSALSRVDD EEHEDNPENE GYEEDSDPNF KGKLYFSLIM  60
IDPSEEDLII SLQKVLGNRW SSIAARMPGR TDNEIKNYWN SRIKKKLRMM GADRHQSPGT  120
SQTAAKSTHC NTEYGNLDVN TSHNSCANEM PHPHFPIFEC DSLSDEQNCE QAAYSSLSKN  180
NEIDLLVEDY VDFLMSLPDD LHADI
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1101107RIKKKLR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008669936.11e-24PREDICTED: transcription factor MYB82-like isoform X1
TrEMBLA0A060D1D45e-25A0A060D1D4_MAIZE; MYB-related transcription factor (Fragment)
STRINGGRMZM2G032180_P012e-24(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP87032545
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12870.17e-20myb domain protein 46